Review



lb thermo fisher scientific bp1426 2  (Thermo Fisher)


Bioz Verified Symbol Thermo Fisher is a verified supplier
Bioz Manufacturer Symbol Thermo Fisher manufactures this product  
  • Logo
  • About
  • News
  • Press Release
  • Team
  • Advisors
  • Partners
  • Contact
  • Bioz Stars
  • Bioz vStars
    • 94
      Buy from Supplier

    Structured Review

    Thermo Fisher lb thermo fisher scientific bp1426 2
    Lb Thermo Fisher Scientific Bp1426 2, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/bp1426/LB+LUR+BERT+BROTH+MILLER+2KG/pm41544147-315-35-36
    Average 94 stars, based on 1 article reviews
    lb thermo fisher scientific bp1426 2 - by Bioz Stars, 2026-09
    94/100 stars

    Images

    Related Articles

    Recombinant:

    Article Title: Allele-specific zinc metalloprotease B influences cardiac damage during invasive pneumococcal disease.
    Article Snippet: REAGENT or RESOURCE SOURCE IDENTIFIER Antibodies Mouse Polyclonal αZmpA sera This study N/A Mouse Polyclonal αZmpB sera This study N/A Rabbit Polyclonal αZmpB sera This study N/A Mouse Polyclonal αZmpC sera This study N/A αCPS Serotype 4 (Rabbit) SSI Diagnostica Cat#: 16747 αRabbit IgG H&L (HRP)-conjugated secondary Abcam Cat#: ab6721; RRID: AB_95547 Goat anti-Rabbit IgG H&L (FITC)-conjugated secondary Invitrogen Cat#: 65-6111 Goat anti-Mouse IgG H&L (FITC)-conjugated secondary Invitrogen Cat#: 31541 Goat anti-Mouse IgG H&L (Alexa Fluor 568)- conjugated secondary Invitrogen Cat#: A-11004 Goat anti-Rabbit IgG H&L (Alexa Fluor 555)- conjugated secondary Abcam Cat#: ab150078; RRID: AB_2722519 Bacterial and virus strains S. pneumoniae strain TIGR4 Dr. Elaine Tuomanen; St. Jude Children’s Hospital, USA N/A S. pneumoniae strain TIGR4ΔzmpA This study N/A S. pneumoniae strain TIGR4ΔzmpB This study N/A S. pneumoniae strain TIGR4ΔzmpC This study N/A S. pneumoniae strain TIGR4Δ0663 This study N/A S. pneumoniae strain TIGR4 GPSC10 This study N/A S. pneumoniae strain TIGR4 GPSC12 This study N/A S. pneumoniae strain TIGR4 GPSC27 This study N/A S. pneumoniae strain TIGR4 GPSC10ΔFIVAR This study N/A S. pneumoniae strain TIGR4ΔzmpBΔply This study N/A S. pneumoniae strain 679647 Dr. David Litt; PHE, UK Clinical isolate of GPSC83 S. pneumoniae strain 471067 Dr. David Litt; PHE, UK Clinical isolate of GPSC10 S. pneumoniae strain UAB CI This study UAB clinical isolate of GPSC10 S. pneumoniae strain HUB09682 Dr. Carmen Ardanuy; Hospital Universitari de Bellvitge, Spain Clinical isolate of GPSC10 S. pneumoniae strain 517597 Dr. David Litt; PHE, UK Clinical isolate of GPSC12 S. pneumoniae strain 703230 Dr. David Litt; PHE, UK Clinical isolate of GPSC12 S. pneumoniae strain CUS_SPN_02 Dr. Luis Felipe Reyes; Universidad de la Sabana, Colombia Clinical isolate of GPSC12 S. pneumoniae strain CUS_SPN_58 Dr. Luis Felipe Reyes; Universidad de la Sabana, Colombia Clinical isolate of GPSC9 E. coli strain BL21(DE3) NEB Cat#: C2527H (Continued on next page) Cell Reports ▪▪, 116574, ▪▪, 2025 17 OPEN ACCESS .. REAGENT or RESOURCE SOURCE IDENTIFIER Recombinant proteins, reagents, and chemicals rZmpA, expressed in E. coli SVHALENHLLLNYNTDYELTSGEKLPLPKEISG YTYIGYIKEGKTTSESEVSNQKSSVATPTKQQK VDYNVTPNFVDHPSTVQAIQEQTPVSSTKPTE VQVVEKPFSTELINPRKEEKQSSDSQEQLAEHK NLETKKEEKISPKEKTGVNTLNPQDEVLSGQLNK PELLYREETMETKIDFQEEIQENPDLAEGTVRVKQ EGKLGKKVEIVRIFSVNKEEVSREIVSTSTTAPSPRIV This study N/A rZmpB, expressed in E. coli YLSGDILKTLGLDTVLEETSAKPGEVTVVEVETPQ SITNQEQARTENQVVETEEAPKEEAPKTEESPKEE PKSEVKPTDDTLPKVEEGKEDSAEPAPVEEVGGE VESKPEEKVAVKPESQPSDKPAEESKVEQAGEPV APREDEKAPVEPEKQPEAPEEEKAVEETPKQEES TPDTKAEETVEPKEETVNQSIEQPKVETPAVEKQTE PTEEPKVEQAGEPVAPREDEQAPTAPVEPEKQPE VPEEEKAVEETPKPEDKIKGIGTKEPVDKSELNNQ IDKASSVSPTDYSTASYNALGPVLETAKG VYASEPVKQPEVNSET This study N/A rZmpC, expressed in E. coli GYIKTKKQDNTELSRTVDGKYSAQRDSQPNS TKTSDVVHSADLEWNQGQGKVSLQGEASGDD GLSEKSSIAADNLSSNDSFASQVEQNPDHKGES VVRPTVPEQGNPVSATTVQSAEEEVLATTNDRP EYKLPLETKGTQEPGHEGEAAVREDLPVYTKPLE TKGTQGPGHEGEAAVREEEPAYTEPLATKGTQE PGHEGKATVREETLEYTEPVATKGTQEPEH EGEAAVEEELPALEV This study N/A Todd-Hewitt Broth Fisher Cat#: 50-201-5330 Difco Yeast Extract, low-dusting (LD) Gibco Cat#: DF210933 Streptomycin Fisher Scientific Cat#: BP910 Kanamycin Sigma-Aldrich Cat#: K4000 LB Broth Fisher Cat#: BP1426-500 Bovine serum albumin (BSA) RPI Cat#: A30075–100.0 Sodium deoxycholate (10%) Fisher Cat#: S285-100 2X Laemmli Sample Buffer Bio-Rad Cat#: 1610737 Tween 20, MP Biomedicals Fisher Cat#: MP1TWEEN 201 Pierce ECL substrate solution Thermo Fisher Cat#: PI32209 Competence-stimulating Peptide-2 (CPS-2) Fisher Cat#: NC1376619 IPTG RPI Cat#: I56000–100.0 Freund’s complete adjuvant Sigma Cat#: F5881-6X10ML Freund’s incomplete adjuvant Sigma Cat#: F5506-10ML Hemoxylin (Stain Harris) CardinalHealth Cat#: S7442-22 Eosin (Stain Eosin-Y) CardinalHealth Cat#: S7442-17 Invitrogen NucBlue Fixed Cell ReadyProbes Reagent (DAPI) Fisher Cat#: R37606 Millipore Sigma FluorSave Reagent Fisher Cat#: 34-578-920ML Prigrow-III Medium Abm Cat#: TM003 Bovine Serum Albumin, Heat Shock Treated Fisher Cat#: BP1600-100 Gibco GlutaMAX Supplement Fisher Cat#: 35-050-061 Gibco Antibiotic/Antimycotic (100X) Fisher Cat#: 15-240-062 Endothelial Cell Growth Factor Corning Cat#: 356006 Claycomb media Sigma-Aldrich Cat#: NC9450441 (Continued on next page) 18 Cell Reports ▪▪, 116574, ▪▪, 2025 OPEN ACCESS .. REAGENT or RESOURCE SOURCE IDENTIFIER (±)-Norepinephrine (+)-bitartrate salt Sigma-Aldrich Cat#: A0937-1G Fibronectin Sigma-Aldrich Cat#: F1141-1MG Heparin sodium salt Sigma-Aldrich Cat#: H4784-1G Dulbecco’s Modified Eagle Medium (DMEM) Fisher Cat#: MT10013CV HEPES Gibco Cat#: 15630 Geltrex Basement Membrane Matrix Gibco Cat#: A1413302 RPMI 1640 media Gibco Cat#: 11875093 L-Ascorbic acid 2-phosphate sesquimagnesium Sigma-Aldrich Cat#: A8960-5G Recombinant human albumin Sigma-Aldrich Cat#: A9731 Penicillin–streptomycin Gibco Cat#: 15070063 B-27 TM Supplement (50X), serum free Gibco Cat#: 17504044 Gentamycin Sigma Cat#: G3632-5G DMSO Sigma-Aldrich Cat#: D2438 Pluronic F-127 Sigma-Aldrich Cat#: P2443 Hanks’ Balanced Salt Solution (HBSS) Gibco Cat#: 14025 CHIR 99021 Tocris Cat#: 4423 Wnt-C59 Tocris Cat#: 5148 meTeSR Plus Kit Temp Cell Technologies Cat# 100-0276 Y-27632 dihydrochloride Fisher Cat#: 12-541-0 Gentle Cell Dissociation Reagent STEMCELL Technologies Cat#: 07174 Critical commercial assays Pierce BCA Protein Assay ThermoScientific Cat#: 23225 CyQUANT LDH Cytotoxicity Assay Invitrogen Cat#: C20300 Experimental models: Cell lines Murine cardiac endothelial cell line (MCEC) Abm Cat#: T0722 Murine atrial cardiomyocyte cell line (HL-1) Millipore Sigma Cat#: SCC065 Human iPSCs FUJIFILM Cellular Dynamics Cat#: CW30356CC1 Experimental models: Organisms/strains C57BL/6 mice The Jackson Laboratory Cat#: 000664 Oligonucleotides zmpA-1 5 ′ -GAGAGAGACTACCAGCTTTTCCTAGAAG-3 ′ This study N/A zmpA-2 5 ′ -TCAAACGGATCGATCCTTAACTCTTGTT TTTCACCAAAATACTTT TCCATTATTCCT-3 ′ This study N/A zmpA-3 5 ′ -ATTTTGGTGAAAAACAAGAGTTAAGGAT CGATCCGTTTGATTTT TAATGGATAATGTGA-3 ′ This study N/A zmpA-4 5 ′ -GCTTTAAAGATTGCTCTCTTTTATGCTTTT GGACGTTTAGTA CCGTATTTAGAAC-3 ′ This study N/A zmpA-5 5 ′ -CTAAACGTCCAAAAGCATAAAAGAGAGCAA TCTTTAAAGCCT ATCTTGACCAAACAAA-3 ′ This study N/A zmpA-6 5 ′ -TGTTGACCTTTTGTGACCCCT-3 ′ This study N/A zmpA-7 5 ′ -GCTTTAAAGATTGCTCTCTTCTCTTGTTTTT CACCAAAATACTTT TCCATTATTCCT-3 ′ This study N/A (Continued on next page) Cell Reports ▪▪, 116574, ▪▪, 2025 19 OPEN ACCESS

    Adjuvant:

    Article Title: Allele-specific zinc metalloprotease B influences cardiac damage during invasive pneumococcal disease.
    Article Snippet: REAGENT or RESOURCE SOURCE IDENTIFIER Antibodies Mouse Polyclonal αZmpA sera This study N/A Mouse Polyclonal αZmpB sera This study N/A Rabbit Polyclonal αZmpB sera This study N/A Mouse Polyclonal αZmpC sera This study N/A αCPS Serotype 4 (Rabbit) SSI Diagnostica Cat#: 16747 αRabbit IgG H&L (HRP)-conjugated secondary Abcam Cat#: ab6721; RRID: AB_95547 Goat anti-Rabbit IgG H&L (FITC)-conjugated secondary Invitrogen Cat#: 65-6111 Goat anti-Mouse IgG H&L (FITC)-conjugated secondary Invitrogen Cat#: 31541 Goat anti-Mouse IgG H&L (Alexa Fluor 568)- conjugated secondary Invitrogen Cat#: A-11004 Goat anti-Rabbit IgG H&L (Alexa Fluor 555)- conjugated secondary Abcam Cat#: ab150078; RRID: AB_2722519 Bacterial and virus strains S. pneumoniae strain TIGR4 Dr. Elaine Tuomanen; St. Jude Children’s Hospital, USA N/A S. pneumoniae strain TIGR4ΔzmpA This study N/A S. pneumoniae strain TIGR4ΔzmpB This study N/A S. pneumoniae strain TIGR4ΔzmpC This study N/A S. pneumoniae strain TIGR4Δ0663 This study N/A S. pneumoniae strain TIGR4 GPSC10 This study N/A S. pneumoniae strain TIGR4 GPSC12 This study N/A S. pneumoniae strain TIGR4 GPSC27 This study N/A S. pneumoniae strain TIGR4 GPSC10ΔFIVAR This study N/A S. pneumoniae strain TIGR4ΔzmpBΔply This study N/A S. pneumoniae strain 679647 Dr. David Litt; PHE, UK Clinical isolate of GPSC83 S. pneumoniae strain 471067 Dr. David Litt; PHE, UK Clinical isolate of GPSC10 S. pneumoniae strain UAB CI This study UAB clinical isolate of GPSC10 S. pneumoniae strain HUB09682 Dr. Carmen Ardanuy; Hospital Universitari de Bellvitge, Spain Clinical isolate of GPSC10 S. pneumoniae strain 517597 Dr. David Litt; PHE, UK Clinical isolate of GPSC12 S. pneumoniae strain 703230 Dr. David Litt; PHE, UK Clinical isolate of GPSC12 S. pneumoniae strain CUS_SPN_02 Dr. Luis Felipe Reyes; Universidad de la Sabana, Colombia Clinical isolate of GPSC12 S. pneumoniae strain CUS_SPN_58 Dr. Luis Felipe Reyes; Universidad de la Sabana, Colombia Clinical isolate of GPSC9 E. coli strain BL21(DE3) NEB Cat#: C2527H (Continued on next page) Cell Reports ▪▪, 116574, ▪▪, 2025 17 OPEN ACCESS .. REAGENT or RESOURCE SOURCE IDENTIFIER Recombinant proteins, reagents, and chemicals rZmpA, expressed in E. coli SVHALENHLLLNYNTDYELTSGEKLPLPKEISG YTYIGYIKEGKTTSESEVSNQKSSVATPTKQQK VDYNVTPNFVDHPSTVQAIQEQTPVSSTKPTE VQVVEKPFSTELINPRKEEKQSSDSQEQLAEHK NLETKKEEKISPKEKTGVNTLNPQDEVLSGQLNK PELLYREETMETKIDFQEEIQENPDLAEGTVRVKQ EGKLGKKVEIVRIFSVNKEEVSREIVSTSTTAPSPRIV This study N/A rZmpB, expressed in E. coli YLSGDILKTLGLDTVLEETSAKPGEVTVVEVETPQ SITNQEQARTENQVVETEEAPKEEAPKTEESPKEE PKSEVKPTDDTLPKVEEGKEDSAEPAPVEEVGGE VESKPEEKVAVKPESQPSDKPAEESKVEQAGEPV APREDEKAPVEPEKQPEAPEEEKAVEETPKQEES TPDTKAEETVEPKEETVNQSIEQPKVETPAVEKQTE PTEEPKVEQAGEPVAPREDEQAPTAPVEPEKQPE VPEEEKAVEETPKPEDKIKGIGTKEPVDKSELNNQ IDKASSVSPTDYSTASYNALGPVLETAKG VYASEPVKQPEVNSET This study N/A rZmpC, expressed in E. coli GYIKTKKQDNTELSRTVDGKYSAQRDSQPNS TKTSDVVHSADLEWNQGQGKVSLQGEASGDD GLSEKSSIAADNLSSNDSFASQVEQNPDHKGES VVRPTVPEQGNPVSATTVQSAEEEVLATTNDRP EYKLPLETKGTQEPGHEGEAAVREDLPVYTKPLE TKGTQGPGHEGEAAVREEEPAYTEPLATKGTQE PGHEGKATVREETLEYTEPVATKGTQEPEH EGEAAVEEELPALEV This study N/A Todd-Hewitt Broth Fisher Cat#: 50-201-5330 Difco Yeast Extract, low-dusting (LD) Gibco Cat#: DF210933 Streptomycin Fisher Scientific Cat#: BP910 Kanamycin Sigma-Aldrich Cat#: K4000 LB Broth Fisher Cat#: BP1426-500 Bovine serum albumin (BSA) RPI Cat#: A30075–100.0 Sodium deoxycholate (10%) Fisher Cat#: S285-100 2X Laemmli Sample Buffer Bio-Rad Cat#: 1610737 Tween 20, MP Biomedicals Fisher Cat#: MP1TWEEN 201 Pierce ECL substrate solution Thermo Fisher Cat#: PI32209 Competence-stimulating Peptide-2 (CPS-2) Fisher Cat#: NC1376619 IPTG RPI Cat#: I56000–100.0 Freund’s complete adjuvant Sigma Cat#: F5881-6X10ML Freund’s incomplete adjuvant Sigma Cat#: F5506-10ML Hemoxylin (Stain Harris) CardinalHealth Cat#: S7442-22 Eosin (Stain Eosin-Y) CardinalHealth Cat#: S7442-17 Invitrogen NucBlue Fixed Cell ReadyProbes Reagent (DAPI) Fisher Cat#: R37606 Millipore Sigma FluorSave Reagent Fisher Cat#: 34-578-920ML Prigrow-III Medium Abm Cat#: TM003 Bovine Serum Albumin, Heat Shock Treated Fisher Cat#: BP1600-100 Gibco GlutaMAX Supplement Fisher Cat#: 35-050-061 Gibco Antibiotic/Antimycotic (100X) Fisher Cat#: 15-240-062 Endothelial Cell Growth Factor Corning Cat#: 356006 Claycomb media Sigma-Aldrich Cat#: NC9450441 (Continued on next page) 18 Cell Reports ▪▪, 116574, ▪▪, 2025 OPEN ACCESS .. REAGENT or RESOURCE SOURCE IDENTIFIER (±)-Norepinephrine (+)-bitartrate salt Sigma-Aldrich Cat#: A0937-1G Fibronectin Sigma-Aldrich Cat#: F1141-1MG Heparin sodium salt Sigma-Aldrich Cat#: H4784-1G Dulbecco’s Modified Eagle Medium (DMEM) Fisher Cat#: MT10013CV HEPES Gibco Cat#: 15630 Geltrex Basement Membrane Matrix Gibco Cat#: A1413302 RPMI 1640 media Gibco Cat#: 11875093 L-Ascorbic acid 2-phosphate sesquimagnesium Sigma-Aldrich Cat#: A8960-5G Recombinant human albumin Sigma-Aldrich Cat#: A9731 Penicillin–streptomycin Gibco Cat#: 15070063 B-27 TM Supplement (50X), serum free Gibco Cat#: 17504044 Gentamycin Sigma Cat#: G3632-5G DMSO Sigma-Aldrich Cat#: D2438 Pluronic F-127 Sigma-Aldrich Cat#: P2443 Hanks’ Balanced Salt Solution (HBSS) Gibco Cat#: 14025 CHIR 99021 Tocris Cat#: 4423 Wnt-C59 Tocris Cat#: 5148 meTeSR Plus Kit Temp Cell Technologies Cat# 100-0276 Y-27632 dihydrochloride Fisher Cat#: 12-541-0 Gentle Cell Dissociation Reagent STEMCELL Technologies Cat#: 07174 Critical commercial assays Pierce BCA Protein Assay ThermoScientific Cat#: 23225 CyQUANT LDH Cytotoxicity Assay Invitrogen Cat#: C20300 Experimental models: Cell lines Murine cardiac endothelial cell line (MCEC) Abm Cat#: T0722 Murine atrial cardiomyocyte cell line (HL-1) Millipore Sigma Cat#: SCC065 Human iPSCs FUJIFILM Cellular Dynamics Cat#: CW30356CC1 Experimental models: Organisms/strains C57BL/6 mice The Jackson Laboratory Cat#: 000664 Oligonucleotides zmpA-1 5 ′ -GAGAGAGACTACCAGCTTTTCCTAGAAG-3 ′ This study N/A zmpA-2 5 ′ -TCAAACGGATCGATCCTTAACTCTTGTT TTTCACCAAAATACTTT TCCATTATTCCT-3 ′ This study N/A zmpA-3 5 ′ -ATTTTGGTGAAAAACAAGAGTTAAGGAT CGATCCGTTTGATTTT TAATGGATAATGTGA-3 ′ This study N/A zmpA-4 5 ′ -GCTTTAAAGATTGCTCTCTTTTATGCTTTT GGACGTTTAGTA CCGTATTTAGAAC-3 ′ This study N/A zmpA-5 5 ′ -CTAAACGTCCAAAAGCATAAAAGAGAGCAA TCTTTAAAGCCT ATCTTGACCAAACAAA-3 ′ This study N/A zmpA-6 5 ′ -TGTTGACCTTTTGTGACCCCT-3 ′ This study N/A zmpA-7 5 ′ -GCTTTAAAGATTGCTCTCTTCTCTTGTTTTT CACCAAAATACTTT TCCATTATTCCT-3 ′ This study N/A (Continued on next page) Cell Reports ▪▪, 116574, ▪▪, 2025 19 OPEN ACCESS

    Staining:

    Article Title: Allele-specific zinc metalloprotease B influences cardiac damage during invasive pneumococcal disease.
    Article Snippet: REAGENT or RESOURCE SOURCE IDENTIFIER Antibodies Mouse Polyclonal αZmpA sera This study N/A Mouse Polyclonal αZmpB sera This study N/A Rabbit Polyclonal αZmpB sera This study N/A Mouse Polyclonal αZmpC sera This study N/A αCPS Serotype 4 (Rabbit) SSI Diagnostica Cat#: 16747 αRabbit IgG H&L (HRP)-conjugated secondary Abcam Cat#: ab6721; RRID: AB_95547 Goat anti-Rabbit IgG H&L (FITC)-conjugated secondary Invitrogen Cat#: 65-6111 Goat anti-Mouse IgG H&L (FITC)-conjugated secondary Invitrogen Cat#: 31541 Goat anti-Mouse IgG H&L (Alexa Fluor 568)- conjugated secondary Invitrogen Cat#: A-11004 Goat anti-Rabbit IgG H&L (Alexa Fluor 555)- conjugated secondary Abcam Cat#: ab150078; RRID: AB_2722519 Bacterial and virus strains S. pneumoniae strain TIGR4 Dr. Elaine Tuomanen; St. Jude Children’s Hospital, USA N/A S. pneumoniae strain TIGR4ΔzmpA This study N/A S. pneumoniae strain TIGR4ΔzmpB This study N/A S. pneumoniae strain TIGR4ΔzmpC This study N/A S. pneumoniae strain TIGR4Δ0663 This study N/A S. pneumoniae strain TIGR4 GPSC10 This study N/A S. pneumoniae strain TIGR4 GPSC12 This study N/A S. pneumoniae strain TIGR4 GPSC27 This study N/A S. pneumoniae strain TIGR4 GPSC10ΔFIVAR This study N/A S. pneumoniae strain TIGR4ΔzmpBΔply This study N/A S. pneumoniae strain 679647 Dr. David Litt; PHE, UK Clinical isolate of GPSC83 S. pneumoniae strain 471067 Dr. David Litt; PHE, UK Clinical isolate of GPSC10 S. pneumoniae strain UAB CI This study UAB clinical isolate of GPSC10 S. pneumoniae strain HUB09682 Dr. Carmen Ardanuy; Hospital Universitari de Bellvitge, Spain Clinical isolate of GPSC10 S. pneumoniae strain 517597 Dr. David Litt; PHE, UK Clinical isolate of GPSC12 S. pneumoniae strain 703230 Dr. David Litt; PHE, UK Clinical isolate of GPSC12 S. pneumoniae strain CUS_SPN_02 Dr. Luis Felipe Reyes; Universidad de la Sabana, Colombia Clinical isolate of GPSC12 S. pneumoniae strain CUS_SPN_58 Dr. Luis Felipe Reyes; Universidad de la Sabana, Colombia Clinical isolate of GPSC9 E. coli strain BL21(DE3) NEB Cat#: C2527H (Continued on next page) Cell Reports ▪▪, 116574, ▪▪, 2025 17 OPEN ACCESS .. REAGENT or RESOURCE SOURCE IDENTIFIER Recombinant proteins, reagents, and chemicals rZmpA, expressed in E. coli SVHALENHLLLNYNTDYELTSGEKLPLPKEISG YTYIGYIKEGKTTSESEVSNQKSSVATPTKQQK VDYNVTPNFVDHPSTVQAIQEQTPVSSTKPTE VQVVEKPFSTELINPRKEEKQSSDSQEQLAEHK NLETKKEEKISPKEKTGVNTLNPQDEVLSGQLNK PELLYREETMETKIDFQEEIQENPDLAEGTVRVKQ EGKLGKKVEIVRIFSVNKEEVSREIVSTSTTAPSPRIV This study N/A rZmpB, expressed in E. coli YLSGDILKTLGLDTVLEETSAKPGEVTVVEVETPQ SITNQEQARTENQVVETEEAPKEEAPKTEESPKEE PKSEVKPTDDTLPKVEEGKEDSAEPAPVEEVGGE VESKPEEKVAVKPESQPSDKPAEESKVEQAGEPV APREDEKAPVEPEKQPEAPEEEKAVEETPKQEES TPDTKAEETVEPKEETVNQSIEQPKVETPAVEKQTE PTEEPKVEQAGEPVAPREDEQAPTAPVEPEKQPE VPEEEKAVEETPKPEDKIKGIGTKEPVDKSELNNQ IDKASSVSPTDYSTASYNALGPVLETAKG VYASEPVKQPEVNSET This study N/A rZmpC, expressed in E. coli GYIKTKKQDNTELSRTVDGKYSAQRDSQPNS TKTSDVVHSADLEWNQGQGKVSLQGEASGDD GLSEKSSIAADNLSSNDSFASQVEQNPDHKGES VVRPTVPEQGNPVSATTVQSAEEEVLATTNDRP EYKLPLETKGTQEPGHEGEAAVREDLPVYTKPLE TKGTQGPGHEGEAAVREEEPAYTEPLATKGTQE PGHEGKATVREETLEYTEPVATKGTQEPEH EGEAAVEEELPALEV This study N/A Todd-Hewitt Broth Fisher Cat#: 50-201-5330 Difco Yeast Extract, low-dusting (LD) Gibco Cat#: DF210933 Streptomycin Fisher Scientific Cat#: BP910 Kanamycin Sigma-Aldrich Cat#: K4000 LB Broth Fisher Cat#: BP1426-500 Bovine serum albumin (BSA) RPI Cat#: A30075–100.0 Sodium deoxycholate (10%) Fisher Cat#: S285-100 2X Laemmli Sample Buffer Bio-Rad Cat#: 1610737 Tween 20, MP Biomedicals Fisher Cat#: MP1TWEEN 201 Pierce ECL substrate solution Thermo Fisher Cat#: PI32209 Competence-stimulating Peptide-2 (CPS-2) Fisher Cat#: NC1376619 IPTG RPI Cat#: I56000–100.0 Freund’s complete adjuvant Sigma Cat#: F5881-6X10ML Freund’s incomplete adjuvant Sigma Cat#: F5506-10ML Hemoxylin (Stain Harris) CardinalHealth Cat#: S7442-22 Eosin (Stain Eosin-Y) CardinalHealth Cat#: S7442-17 Invitrogen NucBlue Fixed Cell ReadyProbes Reagent (DAPI) Fisher Cat#: R37606 Millipore Sigma FluorSave Reagent Fisher Cat#: 34-578-920ML Prigrow-III Medium Abm Cat#: TM003 Bovine Serum Albumin, Heat Shock Treated Fisher Cat#: BP1600-100 Gibco GlutaMAX Supplement Fisher Cat#: 35-050-061 Gibco Antibiotic/Antimycotic (100X) Fisher Cat#: 15-240-062 Endothelial Cell Growth Factor Corning Cat#: 356006 Claycomb media Sigma-Aldrich Cat#: NC9450441 (Continued on next page) 18 Cell Reports ▪▪, 116574, ▪▪, 2025 OPEN ACCESS .. REAGENT or RESOURCE SOURCE IDENTIFIER (±)-Norepinephrine (+)-bitartrate salt Sigma-Aldrich Cat#: A0937-1G Fibronectin Sigma-Aldrich Cat#: F1141-1MG Heparin sodium salt Sigma-Aldrich Cat#: H4784-1G Dulbecco’s Modified Eagle Medium (DMEM) Fisher Cat#: MT10013CV HEPES Gibco Cat#: 15630 Geltrex Basement Membrane Matrix Gibco Cat#: A1413302 RPMI 1640 media Gibco Cat#: 11875093 L-Ascorbic acid 2-phosphate sesquimagnesium Sigma-Aldrich Cat#: A8960-5G Recombinant human albumin Sigma-Aldrich Cat#: A9731 Penicillin–streptomycin Gibco Cat#: 15070063 B-27 TM Supplement (50X), serum free Gibco Cat#: 17504044 Gentamycin Sigma Cat#: G3632-5G DMSO Sigma-Aldrich Cat#: D2438 Pluronic F-127 Sigma-Aldrich Cat#: P2443 Hanks’ Balanced Salt Solution (HBSS) Gibco Cat#: 14025 CHIR 99021 Tocris Cat#: 4423 Wnt-C59 Tocris Cat#: 5148 meTeSR Plus Kit Temp Cell Technologies Cat# 100-0276 Y-27632 dihydrochloride Fisher Cat#: 12-541-0 Gentle Cell Dissociation Reagent STEMCELL Technologies Cat#: 07174 Critical commercial assays Pierce BCA Protein Assay ThermoScientific Cat#: 23225 CyQUANT LDH Cytotoxicity Assay Invitrogen Cat#: C20300 Experimental models: Cell lines Murine cardiac endothelial cell line (MCEC) Abm Cat#: T0722 Murine atrial cardiomyocyte cell line (HL-1) Millipore Sigma Cat#: SCC065 Human iPSCs FUJIFILM Cellular Dynamics Cat#: CW30356CC1 Experimental models: Organisms/strains C57BL/6 mice The Jackson Laboratory Cat#: 000664 Oligonucleotides zmpA-1 5 ′ -GAGAGAGACTACCAGCTTTTCCTAGAAG-3 ′ This study N/A zmpA-2 5 ′ -TCAAACGGATCGATCCTTAACTCTTGTT TTTCACCAAAATACTTT TCCATTATTCCT-3 ′ This study N/A zmpA-3 5 ′ -ATTTTGGTGAAAAACAAGAGTTAAGGAT CGATCCGTTTGATTTT TAATGGATAATGTGA-3 ′ This study N/A zmpA-4 5 ′ -GCTTTAAAGATTGCTCTCTTTTATGCTTTT GGACGTTTAGTA CCGTATTTAGAAC-3 ′ This study N/A zmpA-5 5 ′ -CTAAACGTCCAAAAGCATAAAAGAGAGCAA TCTTTAAAGCCT ATCTTGACCAAACAAA-3 ′ This study N/A zmpA-6 5 ′ -TGTTGACCTTTTGTGACCCCT-3 ′ This study N/A zmpA-7 5 ′ -GCTTTAAAGATTGCTCTCTTCTCTTGTTTTT CACCAAAATACTTT TCCATTATTCCT-3 ′ This study N/A (Continued on next page) Cell Reports ▪▪, 116574, ▪▪, 2025 19 OPEN ACCESS

    Fluorsave:

    Article Title: Allele-specific zinc metalloprotease B influences cardiac damage during invasive pneumococcal disease.
    Article Snippet: REAGENT or RESOURCE SOURCE IDENTIFIER Antibodies Mouse Polyclonal αZmpA sera This study N/A Mouse Polyclonal αZmpB sera This study N/A Rabbit Polyclonal αZmpB sera This study N/A Mouse Polyclonal αZmpC sera This study N/A αCPS Serotype 4 (Rabbit) SSI Diagnostica Cat#: 16747 αRabbit IgG H&L (HRP)-conjugated secondary Abcam Cat#: ab6721; RRID: AB_95547 Goat anti-Rabbit IgG H&L (FITC)-conjugated secondary Invitrogen Cat#: 65-6111 Goat anti-Mouse IgG H&L (FITC)-conjugated secondary Invitrogen Cat#: 31541 Goat anti-Mouse IgG H&L (Alexa Fluor 568)- conjugated secondary Invitrogen Cat#: A-11004 Goat anti-Rabbit IgG H&L (Alexa Fluor 555)- conjugated secondary Abcam Cat#: ab150078; RRID: AB_2722519 Bacterial and virus strains S. pneumoniae strain TIGR4 Dr. Elaine Tuomanen; St. Jude Children’s Hospital, USA N/A S. pneumoniae strain TIGR4ΔzmpA This study N/A S. pneumoniae strain TIGR4ΔzmpB This study N/A S. pneumoniae strain TIGR4ΔzmpC This study N/A S. pneumoniae strain TIGR4Δ0663 This study N/A S. pneumoniae strain TIGR4 GPSC10 This study N/A S. pneumoniae strain TIGR4 GPSC12 This study N/A S. pneumoniae strain TIGR4 GPSC27 This study N/A S. pneumoniae strain TIGR4 GPSC10ΔFIVAR This study N/A S. pneumoniae strain TIGR4ΔzmpBΔply This study N/A S. pneumoniae strain 679647 Dr. David Litt; PHE, UK Clinical isolate of GPSC83 S. pneumoniae strain 471067 Dr. David Litt; PHE, UK Clinical isolate of GPSC10 S. pneumoniae strain UAB CI This study UAB clinical isolate of GPSC10 S. pneumoniae strain HUB09682 Dr. Carmen Ardanuy; Hospital Universitari de Bellvitge, Spain Clinical isolate of GPSC10 S. pneumoniae strain 517597 Dr. David Litt; PHE, UK Clinical isolate of GPSC12 S. pneumoniae strain 703230 Dr. David Litt; PHE, UK Clinical isolate of GPSC12 S. pneumoniae strain CUS_SPN_02 Dr. Luis Felipe Reyes; Universidad de la Sabana, Colombia Clinical isolate of GPSC12 S. pneumoniae strain CUS_SPN_58 Dr. Luis Felipe Reyes; Universidad de la Sabana, Colombia Clinical isolate of GPSC9 E. coli strain BL21(DE3) NEB Cat#: C2527H (Continued on next page) Cell Reports ▪▪, 116574, ▪▪, 2025 17 OPEN ACCESS .. REAGENT or RESOURCE SOURCE IDENTIFIER Recombinant proteins, reagents, and chemicals rZmpA, expressed in E. coli SVHALENHLLLNYNTDYELTSGEKLPLPKEISG YTYIGYIKEGKTTSESEVSNQKSSVATPTKQQK VDYNVTPNFVDHPSTVQAIQEQTPVSSTKPTE VQVVEKPFSTELINPRKEEKQSSDSQEQLAEHK NLETKKEEKISPKEKTGVNTLNPQDEVLSGQLNK PELLYREETMETKIDFQEEIQENPDLAEGTVRVKQ EGKLGKKVEIVRIFSVNKEEVSREIVSTSTTAPSPRIV This study N/A rZmpB, expressed in E. coli YLSGDILKTLGLDTVLEETSAKPGEVTVVEVETPQ SITNQEQARTENQVVETEEAPKEEAPKTEESPKEE PKSEVKPTDDTLPKVEEGKEDSAEPAPVEEVGGE VESKPEEKVAVKPESQPSDKPAEESKVEQAGEPV APREDEKAPVEPEKQPEAPEEEKAVEETPKQEES TPDTKAEETVEPKEETVNQSIEQPKVETPAVEKQTE PTEEPKVEQAGEPVAPREDEQAPTAPVEPEKQPE VPEEEKAVEETPKPEDKIKGIGTKEPVDKSELNNQ IDKASSVSPTDYSTASYNALGPVLETAKG VYASEPVKQPEVNSET This study N/A rZmpC, expressed in E. coli GYIKTKKQDNTELSRTVDGKYSAQRDSQPNS TKTSDVVHSADLEWNQGQGKVSLQGEASGDD GLSEKSSIAADNLSSNDSFASQVEQNPDHKGES VVRPTVPEQGNPVSATTVQSAEEEVLATTNDRP EYKLPLETKGTQEPGHEGEAAVREDLPVYTKPLE TKGTQGPGHEGEAAVREEEPAYTEPLATKGTQE PGHEGKATVREETLEYTEPVATKGTQEPEH EGEAAVEEELPALEV This study N/A Todd-Hewitt Broth Fisher Cat#: 50-201-5330 Difco Yeast Extract, low-dusting (LD) Gibco Cat#: DF210933 Streptomycin Fisher Scientific Cat#: BP910 Kanamycin Sigma-Aldrich Cat#: K4000 LB Broth Fisher Cat#: BP1426-500 Bovine serum albumin (BSA) RPI Cat#: A30075–100.0 Sodium deoxycholate (10%) Fisher Cat#: S285-100 2X Laemmli Sample Buffer Bio-Rad Cat#: 1610737 Tween 20, MP Biomedicals Fisher Cat#: MP1TWEEN 201 Pierce ECL substrate solution Thermo Fisher Cat#: PI32209 Competence-stimulating Peptide-2 (CPS-2) Fisher Cat#: NC1376619 IPTG RPI Cat#: I56000–100.0 Freund’s complete adjuvant Sigma Cat#: F5881-6X10ML Freund’s incomplete adjuvant Sigma Cat#: F5506-10ML Hemoxylin (Stain Harris) CardinalHealth Cat#: S7442-22 Eosin (Stain Eosin-Y) CardinalHealth Cat#: S7442-17 Invitrogen NucBlue Fixed Cell ReadyProbes Reagent (DAPI) Fisher Cat#: R37606 Millipore Sigma FluorSave Reagent Fisher Cat#: 34-578-920ML Prigrow-III Medium Abm Cat#: TM003 Bovine Serum Albumin, Heat Shock Treated Fisher Cat#: BP1600-100 Gibco GlutaMAX Supplement Fisher Cat#: 35-050-061 Gibco Antibiotic/Antimycotic (100X) Fisher Cat#: 15-240-062 Endothelial Cell Growth Factor Corning Cat#: 356006 Claycomb media Sigma-Aldrich Cat#: NC9450441 (Continued on next page) 18 Cell Reports ▪▪, 116574, ▪▪, 2025 OPEN ACCESS .. REAGENT or RESOURCE SOURCE IDENTIFIER (±)-Norepinephrine (+)-bitartrate salt Sigma-Aldrich Cat#: A0937-1G Fibronectin Sigma-Aldrich Cat#: F1141-1MG Heparin sodium salt Sigma-Aldrich Cat#: H4784-1G Dulbecco’s Modified Eagle Medium (DMEM) Fisher Cat#: MT10013CV HEPES Gibco Cat#: 15630 Geltrex Basement Membrane Matrix Gibco Cat#: A1413302 RPMI 1640 media Gibco Cat#: 11875093 L-Ascorbic acid 2-phosphate sesquimagnesium Sigma-Aldrich Cat#: A8960-5G Recombinant human albumin Sigma-Aldrich Cat#: A9731 Penicillin–streptomycin Gibco Cat#: 15070063 B-27 TM Supplement (50X), serum free Gibco Cat#: 17504044 Gentamycin Sigma Cat#: G3632-5G DMSO Sigma-Aldrich Cat#: D2438 Pluronic F-127 Sigma-Aldrich Cat#: P2443 Hanks’ Balanced Salt Solution (HBSS) Gibco Cat#: 14025 CHIR 99021 Tocris Cat#: 4423 Wnt-C59 Tocris Cat#: 5148 meTeSR Plus Kit Temp Cell Technologies Cat# 100-0276 Y-27632 dihydrochloride Fisher Cat#: 12-541-0 Gentle Cell Dissociation Reagent STEMCELL Technologies Cat#: 07174 Critical commercial assays Pierce BCA Protein Assay ThermoScientific Cat#: 23225 CyQUANT LDH Cytotoxicity Assay Invitrogen Cat#: C20300 Experimental models: Cell lines Murine cardiac endothelial cell line (MCEC) Abm Cat#: T0722 Murine atrial cardiomyocyte cell line (HL-1) Millipore Sigma Cat#: SCC065 Human iPSCs FUJIFILM Cellular Dynamics Cat#: CW30356CC1 Experimental models: Organisms/strains C57BL/6 mice The Jackson Laboratory Cat#: 000664 Oligonucleotides zmpA-1 5 ′ -GAGAGAGACTACCAGCTTTTCCTAGAAG-3 ′ This study N/A zmpA-2 5 ′ -TCAAACGGATCGATCCTTAACTCTTGTT TTTCACCAAAATACTTT TCCATTATTCCT-3 ′ This study N/A zmpA-3 5 ′ -ATTTTGGTGAAAAACAAGAGTTAAGGAT CGATCCGTTTGATTTT TAATGGATAATGTGA-3 ′ This study N/A zmpA-4 5 ′ -GCTTTAAAGATTGCTCTCTTTTATGCTTTT GGACGTTTAGTA CCGTATTTAGAAC-3 ′ This study N/A zmpA-5 5 ′ -CTAAACGTCCAAAAGCATAAAAGAGAGCAA TCTTTAAAGCCT ATCTTGACCAAACAAA-3 ′ This study N/A zmpA-6 5 ′ -TGTTGACCTTTTGTGACCCCT-3 ′ This study N/A zmpA-7 5 ′ -GCTTTAAAGATTGCTCTCTTCTCTTGTTTTT CACCAAAATACTTT TCCATTATTCCT-3 ′ This study N/A (Continued on next page) Cell Reports ▪▪, 116574, ▪▪, 2025 19 OPEN ACCESS



    Similar Products

    bp1426 500 carbenicillin gold bio  (Gold Biotechnology Inc)
    96
    Gold Biotechnology Inc bp1426 500 carbenicillin gold bio
    Bp1426 500 Carbenicillin Gold Bio, supplied by Gold Biotechnology Inc, used in various techniques. Bioz Stars score: 96/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/bp1426/Carbenicillin/pm40555231-244-214-216
    Average 96 stars, based on 1 article reviews
    bp1426 500 carbenicillin gold bio - by Bioz Stars, 2026-09
    96/100 stars
    		  Buy from Supplier
    lb thermo fisher scientific bp1426 2  (Thermo Fisher)
    94
    Thermo Fisher lb thermo fisher scientific bp1426 2
    Lb Thermo Fisher Scientific Bp1426 2, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/bp1426/LB+LUR+BERT+BROTH+MILLER+2KG/pm41544147-315-35-36
    Average 94 stars, based on 1 article reviews
    lb thermo fisher scientific bp1426 2 - by Bioz Stars, 2026-09
    94/100 stars
    		  Buy from Supplier
    luria bertani agar  (Thermo Fisher)
    94
    Thermo Fisher luria bertani agar
    Luria Bertani Agar, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/bp1426/LB+LUR+BERT+BROTH+MILLER+2KG/pmc13108208-98-20-22
    Average 94 stars, based on 1 article reviews
    luria bertani agar - by Bioz Stars, 2026-09
    94/100 stars
    		  Buy from Supplier
    bp1426  (Fisher Bioreagents)
    86
    Fisher Bioreagents bp1426
    Bp1426, supplied by Fisher Bioreagents, used in various techniques. Bioz Stars score: 86/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/bp1426/broth+lb/pmc12866094-28-7-4
    Average 86 stars, based on 1 article reviews
    bp1426 - by Bioz Stars, 2026-09
    86/100 stars
    		  Buy from Supplier
    bp1426  (Thermo Fisher)
    94
    Thermo Fisher bp1426
    Bp1426, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/bp1426/LB+LUR+BERT+BROTH+MILLER+2KG/pm41349531-282-85-114
    Average 94 stars, based on 1 article reviews
    bp1426 - by Bioz Stars, 2026-09
    94/100 stars
    		  Buy from Supplier
    bp1426  (Valiant Co Ltd)
    97
    Valiant Co Ltd bp1426
    Bp1426, supplied by Valiant Co Ltd, used in various techniques. Bioz Stars score: 97/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/bp1426/Albumin/pm41349531-282-85-108
    Average 97 stars, based on 1 article reviews
    bp1426 - by Bioz Stars, 2026-09
    97/100 stars
    		  Buy from Supplier
    luria broth medium  (Thermo Fisher)
    94
    Thermo Fisher luria broth medium
    Luria Broth Medium, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/bp1426/LB+LUR+BERT+BROTH+MILLER+2KG/bio_rxiv__2025__09__24__678369-250-18-22
    Average 94 stars, based on 1 article reviews
    luria broth medium - by Bioz Stars, 2026-09
    94/100 stars
    		  Buy from Supplier
    miller thermo fisher scientific bp1426 2 iptg sigma aldrich i6758 5g solulyse  (Thermo Fisher)
    94
    Thermo Fisher miller thermo fisher scientific bp1426 2 iptg sigma aldrich i6758 5g solulyse
    Miller Thermo Fisher Scientific Bp1426 2 Iptg Sigma Aldrich I6758 5g Solulyse, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/bp1426/LB+LUR+BERT+BROTH+MILLER+2KG/pm40992371-257-102-103
    Average 94 stars, based on 1 article reviews
    miller thermo fisher scientific bp1426 2 iptg sigma aldrich i6758 5g solulyse - by Bioz Stars, 2026-09
    94/100 stars
    		  Buy from Supplier
    bp1426 2 congo red sigma aldrich  (Thermo Fisher)
    94
    Thermo Fisher bp1426 2 congo red sigma aldrich
    Bp1426 2 Congo Red Sigma Aldrich, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/bp1426/LB+LUR+BERT+BROTH+MILLER+2KG/pm40668675-183-235-250
    Average 94 stars, based on 1 article reviews
    bp1426 2 congo red sigma aldrich - by Bioz Stars, 2026-09
    94/100 stars
    		  Buy from Supplier
    luria bertani  (Thermo Fisher)
    94
    Thermo Fisher luria bertani
    Luria Bertani, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/bp1426/LB+LUR+BERT+BROTH+MILLER+2KG/pm40651365-64-13-28
    Average 94 stars, based on 1 article reviews
    luria bertani - by Bioz Stars, 2026-09
    94/100 stars
    		  Buy from Supplier

    Image Search Results